Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX8 Rabbit Polyclonal Antibody (HRP)

PAX8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q06710

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PAX8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Bone: femur, head
CS707053 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
OptiWell™ Automation Reservoirs
D3390-8S 50 Units/Case

OptiWell™ Automation Reservoirs

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Respiratory Syncytial Virus,  15nm
GM-46-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Respiratory Syncytial Virus, 15nm

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI1A11]
CF813244 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI1A11]

Sign In for Pricing
View Details
Recombinant Mouse Granulin/GRN/Progranulin Protein (His Tag)
PKSM040703 100 µg

Recombinant Mouse Granulin/GRN/Progranulin Protein (His Tag)

Sign In for Pricing
View Details
Hsp40 (DNAJB1) (1-70) Mouse Monoclonal Antibody [Clone ID: 2E1]
AM26593AF-N 100 µg

Hsp40 (DNAJB1) (1-70) Mouse Monoclonal Antibody [Clone ID: 2E1]

Sign In for Pricing
View Details