Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1A2 Rabbit Polyclonal Antibody (HRP)

EEF1A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HS1, STN, EF1A, STNL, DEE33, MRD38, EEF1AL, EIEE33, EF-1-alpha-2

UniProt

Q05639

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EEF1A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1X5P CRISPR All-in-one AAV vector set (with saCas9)(Human)
35021151 3x 1.0 µg DNA

OR1X5P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
COX7C Protein Vector (Rat) (pPM-C-His)
PV261397 500 ng

COX7C Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Smarce1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4445205 3x 1.0 µg

Smarce1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ALS2 siRNA (Mouse)
MBS8211467-01 15 nmol

ALS2 siRNA (Mouse)

Sign In for Pricing
View Details
ALS2 siRNA (Mouse)
MBS8211467-02 30 nmol

ALS2 siRNA (Mouse)

Sign In for Pricing
View Details
ALS2 siRNA (Mouse)
MBS8211467-03 5x 30 nmol

ALS2 siRNA (Mouse)

Sign In for Pricing
View Details