Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD8 Rabbit Polyclonal Antibody (Biotin)

PSMD8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S14, p31, HIP6, HYPF, Nin1p, Rpn12, HEL-S-91n

UniProt

P48556

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAV38494

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4X2, CT (OR4X2, Olfactory receptor 4X2, Olfactory receptor OR11-105) (MaxLight 750)
MBS6328941-01 0.1 mL

OR4X2, CT (OR4X2, Olfactory receptor 4X2, Olfactory receptor OR11-105) (MaxLight 750)

Sign In for Pricing
View Details
OR4X2, CT (OR4X2, Olfactory receptor 4X2, Olfactory receptor OR11-105) (MaxLight 750)
MBS6328941-02 5x 0.1 mL

OR4X2, CT (OR4X2, Olfactory receptor 4X2, Olfactory receptor OR11-105) (MaxLight 750)

Sign In for Pricing
View Details
Mouse STK31 siRNA
abx935469-01 15 nmol

Mouse STK31 siRNA

Sign In for Pricing
View Details
Mouse STK31 siRNA
abx935469-02 30 nmol

Mouse STK31 siRNA

Sign In for Pricing
View Details
PIWIL1 Rabbit pAb
E45R24668N 50 ul

PIWIL1 Rabbit pAb

Sign In for Pricing
View Details
ACD (Adrenocortical Dysplasia Protein Homolog, PIP1, ACD, POT1 and TIN2-interacting Protein, PTOP, TINT1) (HRP)
MBS6151046-01 0.1 mL

ACD (Adrenocortical Dysplasia Protein Homolog, PIP1, ACD, POT1 and TIN2-interacting Protein, PTOP, TINT1) (HRP)

Sign In for Pricing
View Details