Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELENOF Rabbit Polyclonal Antibody (Biotin)

SELENOF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

45184

UniProt

O60613

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEP15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004252

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bladder cancer with bladder tissue array, including urothelial carcinoma, squamous cell carcinoma,adenocarcinoma and normal tissue, pathololy grade, TNM and clinical stage (AJCC 8.0), 12 case/24 cores(1.5mm), replacing BL243
BL243a 1 Each

Bladder cancer with bladder tissue array, including urothelial carcinoma, squamous cell carcinoma,adenocarcinoma and normal tissue, pathololy grade, TNM and clinical stage (AJCC 8.0), 12 case/24 cores(1.5mm), replacing BL243

Sign In for Pricing
View Details
Rat Retinol Binding Protein 2 (RBP2) ELISA Kit
abx541897 96 Tests

Rat Retinol Binding Protein 2 (RBP2) ELISA Kit

Sign In for Pricing
View Details
PSMA4 (NM_001102668) Human Tagged ORF Clone
RC220432 10 µg

PSMA4 (NM_001102668) Human Tagged ORF Clone

Sign In for Pricing
View Details
Elastase-2B Rabbit Polyclonal Antibody (Biotin)
orb455925 100 µL

Elastase-2B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Anti-Endothelin 2 antibody
SL11280R-01 50 µL

Rabbit Anti-Endothelin 2 antibody

Sign In for Pricing
View Details
Rabbit Anti-Endothelin 2 antibody
SL11280R-02 100 µL

Rabbit Anti-Endothelin 2 antibody

Sign In for Pricing
View Details