Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDOC Rabbit Polyclonal Antibody (Biotin)

ALDOC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALDC

UniProt

P09972

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ALDOC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005156

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKP p65 antibody
70R-34313 0.1 mg

NFKP p65 antibody

Sign In for Pricing
View Details
CACNG6, ID (CACNG6, Voltage-dependent calcium channel gamma-6 subunit, Neuronal voltage-gated calcium channel gamma-6 subunit) (MaxLight 490) discontinued
033136-ML490 100 µL

CACNG6, ID (CACNG6, Voltage-dependent calcium channel gamma-6 subunit, Neuronal voltage-gated calcium channel gamma-6 subunit) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035315-01 20 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035315-02 100 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035315-03 200 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035315-04 1 mL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details