Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH1 Rabbit Polyclonal Antibody (FITC)

MDH1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KAR, MDHA, MOR2, DEE88, MDH-s, EIEE88, HEL-S-32, MGC:1375

UniProt

P40925

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MDH1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005908

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPING1 Rabbit Monoclonal Antibody
TA423980 100 µL

SERPING1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Atrial natriuretic factor (1-28) (rat) TFA
orb1679800-01 1 mg

Atrial natriuretic factor (1-28) (rat) TFA

Sign In for Pricing
View Details
Atrial natriuretic factor (1-28) (rat) TFA
orb1679800-02 5 mg

Atrial natriuretic factor (1-28) (rat) TFA

Sign In for Pricing
View Details
Human KIAA0240 (GLTSCR1L) activation kit by CRISPRa
GA108350 1 Kit

Human KIAA0240 (GLTSCR1L) activation kit by CRISPRa

Sign In for Pricing
View Details
C2CD3 Protein Vector (Mouse) (pPB-C-His)
PV160470 500 ng

C2CD3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 26B1 (Cyp26b1)
MBS1000399-01 0.02 mg (E-Coli)

Recombinant Rat Cytochrome P450 26B1 (Cyp26b1)

Sign In for Pricing
View Details