Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd1 Rabbit Polyclonal Antibody (FITC)

Ankrd1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Alrp, Carp, Crap, MARP

UniProt

Q8R560

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit
MBS9935876-01 48 Well

Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit

Sign In for Pricing
View Details
Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit
MBS9935876-02 96 Well

Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit

Sign In for Pricing
View Details
Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit
MBS9935876-03 5x 96 Well

Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit

Sign In for Pricing
View Details
Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit
MBS9935876-04 10x 96 Well

Horse Long-Chain-Fatty-Acid--Coa Ligase 5 (ACSL5) ELISA Kit

Sign In for Pricing
View Details
Bulk Anti-Human PD-L2 (3.2) Antibody
ICH1031-5mg 5 mg

Bulk Anti-Human PD-L2 (3.2) Antibody

Sign In for Pricing
View Details
C6orf52 Human Gene Knockout Kit (CRISPR)
KN427326 1 Kit

C6orf52 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details