Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT12 Rabbit Polyclonal Antibody (HRP)

NAT12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAK3, Mak3p, NAT12, NAT12P, C14orf35

UniProt

Q147X3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NAT12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001011713

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN7L3B Polyclonal Antibody, Cy5 Conjugated
bs-9754R-Cy5 100 µL

ATXN7L3B Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
B Raf Peptide
AF6171-BP 1 mg

B Raf Peptide

Sign In for Pricing
View Details
NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody (Biotin)
abx272846-01 200 µL

NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody (Biotin)

Sign In for Pricing
View Details
NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody (Biotin)
abx272846-02 1 mL

NAD-Dependent Protein Deacetylase Sirtuin-1 (SIRT1) Antibody (Biotin)

Sign In for Pricing
View Details
Chikungunya virus antibody
10-2719 250 ug

Chikungunya virus antibody

Sign In for Pricing
View Details
Mouse Monoclonal MCAM/CD146 Antibody (OTI5C4) [Biotin]
NBP2-72595B 0.1 mL

Mouse Monoclonal MCAM/CD146 Antibody (OTI5C4) [Biotin]

Sign In for Pricing
View Details