Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ard1b Rabbit Polyclonal Antibody (HRP)

Ard1b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ard1b

UniProt

Q4V8K3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001019913

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJB2 Recombinant Monoclonal Antibody
MBS9019456-01 0.05 mL

GJB2 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
GJB2 Recombinant Monoclonal Antibody
MBS9019456-02 0.1 mL

GJB2 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
GJB2 Recombinant Monoclonal Antibody
MBS9019456-03 5x 0.1 mL

GJB2 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
MEKK1 (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (Biotin)
129568-Biotin 100 µL

MEKK1 (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (Biotin)

Sign In for Pricing
View Details
Goat Kisspeptin 1, KISS-1 GENLISA ELISA
KLG0140 96 Well

Goat Kisspeptin 1, KISS-1 GENLISA ELISA

Sign In for Pricing
View Details
Tubulin polymerization-IN-84
HY-179372 1 Each

Tubulin polymerization-IN-84

Sign In for Pricing
View Details