Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1 Rabbit Polyclonal Antibody (FITC)

METTL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRM8, TRMT8, C12orf1, YDL201w

UniProt

Q9UBP6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_075422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4)
orb2902917-01 20 µg

Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4)

Sign In for Pricing
View Details
Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4)
orb2902917-02 100 µg

Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4)

Sign In for Pricing
View Details
TTC31 sgRNA CRISPR Lentivector (Human) (Target 1)
K2550202 1.0 µg DNA

TTC31 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal Thymidylate Synthase Antibody (TMS715) [Allophycocyanin]
NBP2-34725APC 0.1 mL

Mouse Monoclonal Thymidylate Synthase Antibody (TMS715) [Allophycocyanin]

Sign In for Pricing
View Details
ZSCAN4 (NM_152677) Human Over-expression Lysate
LS201516-100ug 100 µg

ZSCAN4 (NM_152677) Human Over-expression Lysate

Sign In for Pricing
View Details
IgM, Human X-adsorbed (MaxLight 750) discontinued
I1905-15P-ML750 100 µL

IgM, Human X-adsorbed (MaxLight 750) discontinued

Sign In for Pricing
View Details