Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1 Rabbit Polyclonal Antibody (FITC)

METTL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRM8, TRMT8, C12orf1, YDL201w

UniProt

Q9UBP6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_075422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TATA box binding protein/TBP-associated factors (TAF) ELISA Kit
EIA06403Rb 1 Kit

Rabbit TATA box binding protein/TBP-associated factors (TAF) ELISA Kit

Sign In for Pricing
View Details
Adamts18 3'UTR Luciferase Stable Cell Line
TU200277 1.0 mL

Adamts18 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MTUS2 (NM_015233) Human Tagged ORF Clone Lentiviral Particle
RC219139L4V 200 µL

MTUS2 (NM_015233) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HOXC9 (Homeobox Protein Hox-C9, Homeobox Protein Hox-3B, HOX3B) (AP)
MBS6131734-01 0.1 mL

HOXC9 (Homeobox Protein Hox-C9, Homeobox Protein Hox-3B, HOX3B) (AP)

Sign In for Pricing
View Details
HOXC9 (Homeobox Protein Hox-C9, Homeobox Protein Hox-3B, HOX3B) (AP)
MBS6131734-02 5x 0.1 mL

HOXC9 (Homeobox Protein Hox-C9, Homeobox Protein Hox-3B, HOX3B) (AP)

Sign In for Pricing
View Details
WEE1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-23526R-PE-Cy5 100 µL

WEE1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details