Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3A Rabbit Polyclonal Antibody (FITC)

POLR3A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ADDH, C160, HLD7, RPC1, WDRTS, RPC155, hRPC155

UniProt

O14802

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR3A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

156kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_008986

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARMC3 activation kit by CRISPRa
GA116508 1 Kit

Human ARMC3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ApoC3 (Apolipoprotein C3) CLIA Kit
E-CL-H0380-01 24 Tests

Human ApoC3 (Apolipoprotein C3) CLIA Kit

Sign In for Pricing
View Details
Human ApoC3 (Apolipoprotein C3) CLIA Kit
E-CL-H0380-02 48 Tests

Human ApoC3 (Apolipoprotein C3) CLIA Kit

Sign In for Pricing
View Details
Human ApoC3 (Apolipoprotein C3) CLIA Kit
E-CL-H0380-03 96 Tests

Human ApoC3 (Apolipoprotein C3) CLIA Kit

Sign In for Pricing
View Details
Mx1 Mouse Monoclonal Antibody [Clone ID: AM39]
AM26131PU-N 200 µg

Mx1 Mouse Monoclonal Antibody [Clone ID: AM39]

Sign In for Pricing
View Details
Recombinant Human ERN1/IRE1 Protein (aa 465-977)
PKSH030975 50 µg

Recombinant Human ERN1/IRE1 Protein (aa 465-977)

Sign In for Pricing
View Details