Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS2ST1 Rabbit Polyclonal Antibody (HRP)

HS2ST1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NFSRA, dJ604K5.2

UniProt

Q7LGA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HS2ST1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036394

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IL-8 (Interleukin 8) ELISA Kit
MBS2502333-01 24 Tests (Limit 1)

Rabbit IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Rabbit IL-8 (Interleukin 8) ELISA Kit
MBS2502333-02 48 Tests

Rabbit IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Rabbit IL-8 (Interleukin 8) ELISA Kit
MBS2502333-03 96 Tests

Rabbit IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Rabbit IL-8 (Interleukin 8) ELISA Kit
MBS2502333-04 5x 96 Tests

Rabbit IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Rabbit IL-8 (Interleukin 8) ELISA Kit
MBS2502333-05 10x 96 Tests

Rabbit IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Phospho-EEF2 (Tyr443) Blocking Peptide
MBS9618300-01 1 mg

Phospho-EEF2 (Tyr443) Blocking Peptide

Sign In for Pricing
View Details