Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pomgnt1 Rabbit Polyclonal Antibody (FITC)

Pomgnt1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

0610016I07Rik, 4930467B06Rik

UniProt

Q91X88

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1700094D03Rik shRNA (UAS) - Lentiviral mouse 1700094D03Rik shRNA (UAS, iRFP) plasmid
GTR15246928 1 Vial

Lentiviral mouse 1700094D03Rik shRNA (UAS) - Lentiviral mouse 1700094D03Rik shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
GNAO1 AAV Vector (Mouse) (CMV)
22301104 1 µg

GNAO1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
ARRDC5 sgRNA CRISPR Lentivector (Human) (Target 2)
K0127503 1.0 µg DNA

ARRDC5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat PCNA (Proliferating Cell Nuclear Antigen) Microsample ELISA Kit
ELK8614MS-01 48 Tests

Rat PCNA (Proliferating Cell Nuclear Antigen) Microsample ELISA Kit

Sign In for Pricing
View Details
Rat PCNA (Proliferating Cell Nuclear Antigen) Microsample ELISA Kit
ELK8614MS-02 96 Tests

Rat PCNA (Proliferating Cell Nuclear Antigen) Microsample ELISA Kit

Sign In for Pricing
View Details
Rat PCNA (Proliferating Cell Nuclear Antigen) Microsample ELISA Kit
ELK8614MS-03 5x 96 Tests

Rat PCNA (Proliferating Cell Nuclear Antigen) Microsample ELISA Kit

Sign In for Pricing
View Details