Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG13 Rabbit Polyclonal Antibody (Biotin)

ALG13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDG1S, DEE36, EIEE36, MDS031, TDRD13, CXorf45, GLT28D1, YGL047W

UniProt

Q9NP73

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_060936

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal peptidase complex subunit 3 (SPCS3) Rat ELISA Kit
H0870 96 Tests

Signal peptidase complex subunit 3 (SPCS3) Rat ELISA Kit

Sign In for Pricing
View Details
ERβ (phospho Ser105) Rabbit Polyclonal Antibody
APRab04644-01 20 µL

ERβ (phospho Ser105) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERβ (phospho Ser105) Rabbit Polyclonal Antibody
APRab04644-02 50 µL

ERβ (phospho Ser105) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERβ (phospho Ser105) Rabbit Polyclonal Antibody
APRab04644-03 100 µL

ERβ (phospho Ser105) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERβ (phospho Ser105) Rabbit Polyclonal Antibody
APRab04644-04 200 µL

ERβ (phospho Ser105) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human BUD31 Recombinant Protein
PROTP41223-100ug 100 µg

Human BUD31 Recombinant Protein

Sign In for Pricing
View Details