Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN3 Rabbit Polyclonal Antibody (HRP)

NSUN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MST077, COXPD48, MSTP077

UniProt

Q9H649

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NSUN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRDMT1 Rabbit Polyclonal Antibody
orb626476-01 50 µg

TRDMT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRDMT1 Rabbit Polyclonal Antibody
orb626476-02 100 µg

TRDMT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Stromelysin-2 MMP10 Antibody Picoband® (Dylight488 Conjugate)
PA1380-Dylight488 100 µg

Anti-Stromelysin-2 MMP10 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Anti-JAK3 Rabbit Monoclonal Antibody
M02598-2-20μl 20 µL

Anti-JAK3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Krt6b Pre-designed siRNA Set A
SI107351A 1 Each

Mouse Krt6b Pre-designed siRNA Set A

Sign In for Pricing
View Details
HLF   monoclonal antibody
MB12066 50ul

HLF monoclonal antibody

Sign In for Pricing
View Details