Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT7 Rabbit Polyclonal Antibody (HRP)

B3GNT7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Beta3GnT7

UniProt

Q8NFL0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P18 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV777496 1.0 µg DNA

RPL21P18 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ACTG1 (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 405)
MBS6188717-01 0.1 mL

ACTG1 (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 405)

Sign In for Pricing
View Details
ACTG1 (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 405)
MBS6188717-02 5x 0.1 mL

ACTG1 (Actin, Cytoplasmic 2, Gamma-actin, Actin, Cytoplasmic 2, N-terminally Processed, ACTG, ACTB) (MaxLight 405)

Sign In for Pricing
View Details
FAM38A (PIEZO1) Human shRNA Lentiviral Particle (Locus ID 9780)
TL313084V 500 µL Each

FAM38A (PIEZO1) Human shRNA Lentiviral Particle (Locus ID 9780)

Sign In for Pricing
View Details
OTSC7-set siRNA/shRNA/RNAi Lentivector (Human)
35812091 4x 500 ng

OTSC7-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Eif1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4590606 1.0 µg DNA

Eif1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details