Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT7 Rabbit Polyclonal Antibody (HRP)

B3GNT7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Beta3GnT7

UniProt

Q8NFL0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gcgr (NM_008101) Mouse Untagged Clone
MC203290 10 µg

Gcgr (NM_008101) Mouse Untagged Clone

Sign In for Pricing
View Details
Goat anti-Q fever antibody, anti-Q-Ab ELISA KIT
ED0009GO-01 96 Well

Goat anti-Q fever antibody, anti-Q-Ab ELISA KIT

Sign In for Pricing
View Details
Goat anti-Q fever antibody, anti-Q-Ab ELISA KIT
ED0009GO-02 5x 96 Tests

Goat anti-Q fever antibody, anti-Q-Ab ELISA KIT

Sign In for Pricing
View Details
Goat anti-Q fever antibody, anti-Q-Ab ELISA KIT
ED0009GO-03 10x 96 Tests

Goat anti-Q fever antibody, anti-Q-Ab ELISA KIT

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2138361-01 0.1 mL

Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2138361-02 0.2 mL

Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details