Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDYL2 Rabbit Polyclonal Antibody (HRP)

CDYL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PCCP1

UniProt

Q8N8U2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDYL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689555

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Efs shRNA (UAS) - Lentiviral mouse Efs shRNA (UAS, iRFP) plasmid
GTR15242824 1 Vial

Lentiviral mouse Efs shRNA (UAS) - Lentiviral mouse Efs shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ICOS Recombinant Rabbit mAb
BS48105-01 50 µL

ICOS Recombinant Rabbit mAb

Sign In for Pricing
View Details
ICOS Recombinant Rabbit mAb
BS48105-02 100 µL

ICOS Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mmu-miR-206-5p inhibitor
HY-RI02818-01 5 nmol

Mmu-miR-206-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-206-5p inhibitor
HY-RI02818-02 20 nmol

Mmu-miR-206-5p inhibitor

Sign In for Pricing
View Details
HLA-DMA (HLA class II Histocompatibility Antigen, DM alpha Chain, MHC class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) discontinued
360416-01 50 µL

HLA-DMA (HLA class II Histocompatibility Antigen, DM alpha Chain, MHC class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) discontinued

Sign In for Pricing
View Details