Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPPA Rabbit Polyclonal Antibody (Biotin)

GMPPA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AAMR

UniProt

Q96IJ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GMPPA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_995319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) APC
MBS6136307-01 0.1 mL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) APC

Sign In for Pricing
View Details
DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) APC
MBS6136307-02 5x 0.1 mL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) APC

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida UPF0213 ASA_0550 Protein (aa 1-136)
VAng-Lsx1140-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Salmonicida UPF0213 ASA_0550 Protein (aa 1-136)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Bcl2 Associated X Protein (Bax)
MBS2054102-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Bcl2 Associated X Protein (Bax)
MBS2054102-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Bcl2 Associated X Protein (Bax)
MBS2054102-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Bcl2 Associated X Protein (Bax)

Sign In for Pricing
View Details