Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM63C Rabbit Polyclonal Antibody (FITC)

TMEM63C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSC1, hsCSC1, C14orf171

UniProt

Q9P1W3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM63C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065164

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPN1L Protein Vector (Human) (pPM-C-HA)
PV109472 500 ng

PABPN1L Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Quantifoil R 10/10 ; Gold 400 Mesh 100/pk
M-CEM-Q4100AR1010 100 Grids

Quantifoil R 10/10 ; Gold 400 Mesh 100/pk

Sign In for Pricing
View Details
Calcineurin A alpha (Protein Phosphatase 2B, A subunit, alpha isoform, CnA alpha) (MaxLight 750)
MBS6466512-01 0.1 mL

Calcineurin A alpha (Protein Phosphatase 2B, A subunit, alpha isoform, CnA alpha) (MaxLight 750)

Sign In for Pricing
View Details
Calcineurin A alpha (Protein Phosphatase 2B, A subunit, alpha isoform, CnA alpha) (MaxLight 750)
MBS6466512-02 5x 0.1 mL

Calcineurin A alpha (Protein Phosphatase 2B, A subunit, alpha isoform, CnA alpha) (MaxLight 750)

Sign In for Pricing
View Details
OPCA04232-500UG - CYP21A2 Recombinant Protein (Human)
OPCA04232-500UG 500 µg

OPCA04232-500UG - CYP21A2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Vibrio sp. RT PCR kit
RTq-V248-50D 50T

Vibrio sp. RT PCR kit

Sign In for Pricing
View Details