Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp10d Rabbit Polyclonal Antibody (HRP)

Atp10d Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Atp10d

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002725021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Zona Pellucida Glycoprotein 2, Sperm Receptor ELISA Kit
MBS102102 Inquire

Fish Zona Pellucida Glycoprotein 2, Sperm Receptor ELISA Kit

Sign In for Pricing
View Details
IL33 (C9orf26, IL1F11, NFHEV, Interleukin-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, DKFZp586H0523, DVS27, NF-HEV, RP11-575C20.2) (MaxLight 650)
MBS6222750-01 0.1 mL

IL33 (C9orf26, IL1F11, NFHEV, Interleukin-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, DKFZp586H0523, DVS27, NF-HEV, RP11-575C20.2) (MaxLight 650)

Sign In for Pricing
View Details
IL33 (C9orf26, IL1F11, NFHEV, Interleukin-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, DKFZp586H0523, DVS27, NF-HEV, RP11-575C20.2) (MaxLight 650)
MBS6222750-02 5x 0.1 mL

IL33 (C9orf26, IL1F11, NFHEV, Interleukin-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, DKFZp586H0523, DVS27, NF-HEV, RP11-575C20.2) (MaxLight 650)

Sign In for Pricing
View Details
LepA Antibody
orb820737 2 mg

LepA Antibody

Sign In for Pricing
View Details
Apol7b 3'UTR GFP Stable Cell Line
TU151976 1.0 mL

Apol7b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCDC91 Lentiviral Activation Particles (m2)
sc-426326-LAC-2 200 µL

CCDC91 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details