Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAT5 Rabbit Polyclonal Antibody (HRP)

BAT5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BAT5, NG26, PP199, hBAT5, D6S82E

UniProt

O95870

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BAT5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine GI Panel PCR Kit
VT057100T 100 Reactions

Canine GI Panel PCR Kit

Sign In for Pricing
View Details
Zebrafish Ceruloplasmin/CP Rabbit Polyclonal Antibody (HRP)
orb3003849 100 µg

Zebrafish Ceruloplasmin/CP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
HOXA10 (NM_018951) Human Over-expression Lysate
LS003206 100 µg

HOXA10 (NM_018951) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)
MBS7023110-01 0.02 mg

Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Sign In for Pricing
View Details
Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)
MBS7023110-02 0.1 mg

Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Sign In for Pricing
View Details
Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)
MBS7023110-03 5x 0.1 mg

Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Sign In for Pricing
View Details