Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A23 Rabbit Polyclonal Antibody (Biotin)

SLC22A23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C6orf85

UniProt

A1A5C7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC22A23

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, H&L (FITC)
I1904-53G3 500 µg

IgG, H&L (FITC)

Sign In for Pricing
View Details
Asrij Antibody
orb805801 2 mg

Asrij Antibody

Sign In for Pricing
View Details
MSTO1 Rabbit Polyclonal Antibody
orb513734 100 µg

MSTO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44 (HCAM Std., LHR, BA-1, Chondroitin Sulfate Proteoglycan 8, CSPG8, Epican, Extracellular Matrix Receptor III, ECM III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan Sulfate Proteoglycan, He
MBS6236646-01 0.1 mL

CD44 (HCAM Std., LHR, BA-1, Chondroitin Sulfate Proteoglycan 8, CSPG8, Epican, Extracellular Matrix Receptor III, ECM III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan Sulfate Proteoglycan, He

Sign In for Pricing
View Details
CD44 (HCAM Std., LHR, BA-1, Chondroitin Sulfate Proteoglycan 8, CSPG8, Epican, Extracellular Matrix Receptor III, ECM III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan Sulfate Proteoglycan, He
MBS6236646-02 5x 0.1 mL

CD44 (HCAM Std., LHR, BA-1, Chondroitin Sulfate Proteoglycan 8, CSPG8, Epican, Extracellular Matrix Receptor III, ECM III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, hematopoietic cell E- and L-selectin ligand, Heparan Sulfate Proteoglycan, He

Sign In for Pricing
View Details
Human TSPAN11 Knockout A549 cell line
GTR15419983 1 Vial

Human TSPAN11 Knockout A549 cell line

Sign In for Pricing
View Details