Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN2 Rabbit Polyclonal Antibody (FITC)

CLSTN2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CS2, CSTN2, CDHR13, ALC-GAMMA, alcagamma

UniProt

Q9H4D0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence ICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

107 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_071414

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Component 1q Receptor / C1QR1 (CD93) Antibody
abx242396-01 50 µL

Complement Component 1q Receptor / C1QR1 (CD93) Antibody

Sign In for Pricing
View Details
Complement Component 1q Receptor / C1QR1 (CD93) Antibody
abx242396-02 100 µL

Complement Component 1q Receptor / C1QR1 (CD93) Antibody

Sign In for Pricing
View Details
Rasgrf2 sgRNA CRISPR Lentivector set (Rat)
K6948401 3x 1.0 µg

Rasgrf2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Biotinylated Anti-GPR87 antibody (DMC478) ; IgG1 Chimeric mAb
12-9454B-100 100 µg

Biotinylated Anti-GPR87 antibody (DMC478) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details
Rabbit Anti-Human Papilloma Virus 11 late protein L1 (HPV11L1) IgG ELISA kit, quantitative, 96 tests
550-211-PRG 1 Kit

Rabbit Anti-Human Papilloma Virus 11 late protein L1 (HPV11L1) IgG ELISA kit, quantitative, 96 tests

Sign In for Pricing
View Details
CD79a Antibody
orb2640022 100 µg

CD79a Antibody

Sign In for Pricing
View Details