Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTA Rabbit Polyclonal Antibody (HRP)

TCTA Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P57738

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCTA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071503

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SIGLEC6 (NM_198845) AAV Particle
RC206611A1V 250 µL

Human SIGLEC6 (NM_198845) AAV Particle

Sign In for Pricing
View Details
Human SLC25A52 Pre-designed siRNA Set A
SI014991A 1 Each

Human SLC25A52 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CSNK1G1 Mouse Monoclonal Antibody [Clone ID: LBI8F9]
AMM17304V 100 µL

CSNK1G1 Mouse Monoclonal Antibody [Clone ID: LBI8F9]

Sign In for Pricing
View Details
Recombinant Manduca sexta Segmentation protein Runt (RUNT)
MBS1484790-01 0.02 mg (E-Coli)

Recombinant Manduca sexta Segmentation protein Runt (RUNT)

Sign In for Pricing
View Details
Recombinant Manduca sexta Segmentation protein Runt (RUNT)
MBS1484790-02 0.1 mg (E-Coli)

Recombinant Manduca sexta Segmentation protein Runt (RUNT)

Sign In for Pricing
View Details
Recombinant Manduca sexta Segmentation protein Runt (RUNT)
MBS1484790-03 0.02 mg (Yeast)

Recombinant Manduca sexta Segmentation protein Runt (RUNT)

Sign In for Pricing
View Details