Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK5, Human (sf9, His)

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (sf9, His) is the recombinant human-derived PAK5 protein, expressed by sf9 insect cells , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PAK5 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pak5-protein-human-baculovirus-his.html

Smiles

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Molecular Formula

57144 (Gene_ID) Q8TB93 (M1-Q293) (Accession)

Molecular Weight

Approximately 34.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit
MBS281078-01 48 Tests

Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit

Ask
View Details
Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit
MBS281078-02 96 Tests

Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit

Ask
View Details
Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit
MBS281078-03 5x 96 Tests

Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit

Ask
View Details
Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit
MBS281078-04 10x 96 Tests

Human Potassium voltage-gated channel subfamily S member 3 (KCNS3) ELISA Kit

Ask
View Details
NTAN1 Polyclonal Antibody
MBS2560858-01 0.02 mL

NTAN1 Polyclonal Antibody

Ask
View Details
NTAN1 Polyclonal Antibody
MBS2560858-02 0.06 mL

NTAN1 Polyclonal Antibody

Ask
View Details