Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK5, Human (sf9, His)

PAK5 is a dynamic serine/threonine kinase that affects cytoskeletal regulation, cell migration, proliferation, and survival through multiple pathways. Activation triggers autophosphorylation, affecting RAF1 kinase activity and promoting cell survival through BAD phosphorylation. PAK5 Protein, Human (sf9, His) is the recombinant human-derived PAK5 protein, expressed by sf9 insect cells , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PAK5 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pak5-protein-human-baculovirus-his.html

Smiles

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Molecular Formula

57144 (Gene_ID) Q8TB93 (M1-Q293) (Accession)

Molecular Weight

Approximately 34.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC9 (10I3) Rabbit Monoclonal Antibody
E28M4860 100 µL

HDAC9 (10I3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MKP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1851R-BF594-01 20 µL

MKP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
MKP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1851R-BF594-02 100 µL

MKP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Erich5 Mouse shRNA Plasmid (Locus ID 239368)
TL514717 1 Kit

Erich5 Mouse shRNA Plasmid (Locus ID 239368)

Sign In for Pricing
View Details
TCF15 Antibody (Center)
MBS9206718-01 0.08 mL

TCF15 Antibody (Center)

Sign In for Pricing
View Details
TCF15 Antibody (Center)
MBS9206718-02 0.4 mL

TCF15 Antibody (Center)

Sign In for Pricing
View Details