Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM106C Rabbit Polyclonal Antibody (HRP)

TMEM106C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC111210, MGC5576

UniProt

Q9BVX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM106C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_076961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFB1 Rabbit pAb (APR23240N)
APR23240N-01 50 µL

TGFB1 Rabbit pAb (APR23240N)

Sign In for Pricing
View Details
TGFB1 Rabbit pAb (APR23240N)
APR23240N-02 100 µL

TGFB1 Rabbit pAb (APR23240N)

Sign In for Pricing
View Details
TGFB1 Rabbit pAb (APR23240N)
APR23240N-03 200 µL

TGFB1 Rabbit pAb (APR23240N)

Sign In for Pricing
View Details
Lrrc24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3349507 1.0 µg DNA

Lrrc24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
DNM1P48 3'UTR Luciferase Stable Cell Line
TU006215 1.0 mL

DNM1P48 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cis-4-Aminocyclohexanecarboxylic acid methyl ester hydrochloride
261381-01 1 g

Cis-4-Aminocyclohexanecarboxylic acid methyl ester hydrochloride

Sign In for Pricing
View Details