Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM106C Rabbit Polyclonal Antibody (HRP)

TMEM106C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC111210, MGC5576

UniProt

Q9BVX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM106C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_076961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (4- (benzo[d]oxazol-2-yl) phenyl) naphtho[2,3-b]benzofuran-3-amine
JH916038 1 Each

N- (4- (benzo[d]oxazol-2-yl) phenyl) naphtho[2,3-b]benzofuran-3-amine

Sign In for Pricing
View Details
Platelet Derived Growth Factor Subunit B (PDGFB) BioAssayTM ELISA Kit (Human)
027516 96 Tests

Platelet Derived Growth Factor Subunit B (PDGFB) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Speer4a Mouse qPCR Primer Pair (NM_029376)
MP216104 200 Reactions

Speer4a Mouse qPCR Primer Pair (NM_029376)

Sign In for Pricing
View Details
Anti-Mouse IgG (H+L) - 100nm Gold NanoUrchins
GUAC-100-02-10 0.5 mL

Anti-Mouse IgG (H+L) - 100nm Gold NanoUrchins

Sign In for Pricing
View Details
Density Premium Std 0.6582g/mL at 60C - 100ML
DEN60010PY 100 mL

Density Premium Std 0.6582g/mL at 60C - 100ML

Sign In for Pricing
View Details
Klrb1b sgRNA CRISPR Lentivector set (Rat)
K6815601 3x 1.0 µg

Klrb1b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details