Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RETREG2 Rabbit Polyclonal Antibody (Biotin)

RETREG2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAG-2, C2orf17, FAM134A

UniProt

Q8NC44

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM134A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077269

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanylate Cyclase alpha-2, Soluble, NT (Guanylate Cyclase Soluble Subunit alpha-2, Guanylate Cyclase 1 Soluble alpha 2, GCS-alpha-2, GC-SA2, GUC1A2, GUCSA2, GUCY1A2) (APC) discontinued
G9804-47A-APC 200 µL

Guanylate Cyclase alpha-2, Soluble, NT (Guanylate Cyclase Soluble Subunit alpha-2, Guanylate Cyclase 1 Soluble alpha 2, GCS-alpha-2, GC-SA2, GUC1A2, GUCSA2, GUCY1A2) (APC) discontinued

Sign In for Pricing
View Details
S1PR1 Antibody
A21034-50UG 50 µg

S1PR1 Antibody

Sign In for Pricing
View Details
Olr634 (NM_001000647) Rat Tagged Lenti ORF Clone
RR204639L3 10 µg

Olr634 (NM_001000647) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Methyl 2- (dihydro-2H-thiopyran-3 (4H) -ylidene) acetate
OR1051162 250 mg

Methyl 2- (dihydro-2H-thiopyran-3 (4H) -ylidene) acetate

Sign In for Pricing
View Details
Tanshinone IIA sulfonic sodium 500mg
A14595-500 500 mg

Tanshinone IIA sulfonic sodium 500mg

Sign In for Pricing
View Details
GSK3 beta (GSK3B) (NM_002093) Human Untagged Clone
SC118826 10 µg

GSK3 beta (GSK3B) (NM_002093) Human Untagged Clone

Sign In for Pricing
View Details