Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MANEAL Rabbit Polyclonal Antibody (FITC)

MANEAL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP11-109P14.3

UniProt

Q5VSG8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MANEAL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUS1 (Pseudouridylate Synthase 1, tRNA Pseudouridine Synthase A, Mitochondrial, tRNA Pseudouridine(38-40) Synthase, tRNA Pseudouridylate Synthase I, tRNA-uridine Isomerase I, MLASA1, PP8985) (AP)
MBS6133233-01 0.1 mL

PUS1 (Pseudouridylate Synthase 1, tRNA Pseudouridine Synthase A, Mitochondrial, tRNA Pseudouridine(38-40) Synthase, tRNA Pseudouridylate Synthase I, tRNA-uridine Isomerase I, MLASA1, PP8985) (AP)

Sign In for Pricing
View Details
PUS1 (Pseudouridylate Synthase 1, tRNA Pseudouridine Synthase A, Mitochondrial, tRNA Pseudouridine(38-40) Synthase, tRNA Pseudouridylate Synthase I, tRNA-uridine Isomerase I, MLASA1, PP8985) (AP)
MBS6133233-02 5x 0.1 mL

PUS1 (Pseudouridylate Synthase 1, tRNA Pseudouridine Synthase A, Mitochondrial, tRNA Pseudouridine(38-40) Synthase, tRNA Pseudouridylate Synthase I, tRNA-uridine Isomerase I, MLASA1, PP8985) (AP)

Sign In for Pricing
View Details
Human VWF Nanobody
E55A15823 100 µg

Human VWF Nanobody

Sign In for Pricing
View Details
TUBB antibody - N-terminal region
MBS3212384-01 0.1 mL

TUBB antibody - N-terminal region

Sign In for Pricing
View Details
TUBB antibody - N-terminal region
MBS3212384-02 5x 0.1 mL

TUBB antibody - N-terminal region

Sign In for Pricing
View Details
Mouse Anti-Muscle actin Recombinant Antibody (clone 4G10)
MOB-0123F Each

Mouse Anti-Muscle actin Recombinant Antibody (clone 4G10)

Sign In for Pricing
View Details