Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clmp Rabbit Polyclonal Antibody (HRP)

Clmp Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACAM, Asam, Ol16

UniProt

Q8K1G0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Clmp

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_775177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component Antibody
abx140260 0.1 mg

IgA Secretory Component Antibody

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2151336-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2151336-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2151336-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2151336-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2151336-05 5 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Beta (IL1b)

Sign In for Pricing
View Details