Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAQR6 Rabbit Polyclonal Antibody (FITC)

PAQR6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRdelta

UniProt

Q5TCK9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PAQR6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse YTH domain family protein 3 (YTHDF3) ELISA Kit
abx553901 96 Tests

Mouse YTH domain family protein 3 (YTHDF3) ELISA Kit

Sign In for Pricing
View Details
Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit
MBS068899-01 48 Well

Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit
MBS068899-02 96 Well

Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit
MBS068899-03 5x 96 Well

Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit
MBS068899-04 10x 96 Well

Sheep Mannose Receptor C Type 1 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
CHRFAM7A siRNA (Human)
MBS8238577-01 15 nmol

CHRFAM7A siRNA (Human)

Sign In for Pricing
View Details