Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PQLC1 Rabbit Polyclonal Antibody (HRP)

PQLC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PQLC1

UniProt

Q8N2U9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PQLC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_079354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Calpain 10 Protein - (Dry Ice)
H00011132-P01-2ug 2 µg

Recombinant Human Calpain 10 Protein - (Dry Ice)

Sign In for Pricing
View Details
ZSCAN22, ID (ZSCAN22, HKR2, ZNF50, Zinc finger and SCAN domain-containing protein 22, Krueppel-related zinc finger protein 2, Protein HKR2, Zinc finger protein 50) (MaxLight 550)
MBS6368215-01 0.1 mL

ZSCAN22, ID (ZSCAN22, HKR2, ZNF50, Zinc finger and SCAN domain-containing protein 22, Krueppel-related zinc finger protein 2, Protein HKR2, Zinc finger protein 50) (MaxLight 550)

Sign In for Pricing
View Details
ZSCAN22, ID (ZSCAN22, HKR2, ZNF50, Zinc finger and SCAN domain-containing protein 22, Krueppel-related zinc finger protein 2, Protein HKR2, Zinc finger protein 50) (MaxLight 550)
MBS6368215-02 5x 0.1 mL

ZSCAN22, ID (ZSCAN22, HKR2, ZNF50, Zinc finger and SCAN domain-containing protein 22, Krueppel-related zinc finger protein 2, Protein HKR2, Zinc finger protein 50) (MaxLight 550)

Sign In for Pricing
View Details
Anti-MFN2 Antibody
E38A4464 100 µg -100 µL

Anti-MFN2 Antibody

Sign In for Pricing
View Details
ARHGAP1 (NM_004308) Human Over-expression Lysate
LS000392 100 µg

ARHGAP1 (NM_004308) Human Over-expression Lysate

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor, Vascular Permeability Factor, VEGFA, VPF) (MaxLight 750)
MBS6247281-01 0.1 mL

VEGF (Vascular Endothelial Growth Factor, Vascular Permeability Factor, VEGFA, VPF) (MaxLight 750)

Sign In for Pricing
View Details