Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H13 Rabbit Polyclonal Antibody (Biotin)

H13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Spp, H-13, Hm13, PSL3, AV020344, 1200006O09Rik, 4930443L17Rik, 5031424B04Rik

UniProt

Q9D8V0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034506

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL1 siRNA (Rat)
CRR1827-01 15 nmol

ARL1 siRNA (Rat)

Sign In for Pricing
View Details
ARL1 siRNA (Rat)
CRR1827-02 30 nmol

ARL1 siRNA (Rat)

Sign In for Pricing
View Details
EGR2 Protein Vector (Human) (pPB-C-His)
PV013749 500 ng

EGR2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Bovine Fatty Acid Binding Protein 8, Myelin ELISA Kit
MBS088552-01 48 Well

Bovine Fatty Acid Binding Protein 8, Myelin ELISA Kit

Sign In for Pricing
View Details
Bovine Fatty Acid Binding Protein 8, Myelin ELISA Kit
MBS088552-02 96 Well

Bovine Fatty Acid Binding Protein 8, Myelin ELISA Kit

Sign In for Pricing
View Details
Bovine Fatty Acid Binding Protein 8, Myelin ELISA Kit
MBS088552-03 5x 96 Well

Bovine Fatty Acid Binding Protein 8, Myelin ELISA Kit

Sign In for Pricing
View Details