Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDPD5 Rabbit Polyclonal Antibody (HRP)

GDPD5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GDE2, PP1665

UniProt

Q8WTR4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GDPD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKAL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vipivotide tetraxetan (PSMA-617)
S8670-2mg 2 mg

Vipivotide tetraxetan (PSMA-617)

Sign In for Pricing
View Details
Recombinant Human ERFE Protein, N-His
orb2830967-01 20 µg

Recombinant Human ERFE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ERFE Protein, N-His
orb2830967-02 50 µg

Recombinant Human ERFE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ERFE Protein, N-His
orb2830967-03 100 µg

Recombinant Human ERFE Protein, N-His

Sign In for Pricing
View Details
MYLK4, CT (MYLK4, SGK085, Myosin light chain kinase family member 4, Sugen kinase 85)
038742 200 µL

MYLK4, CT (MYLK4, SGK085, Myosin light chain kinase family member 4, Sugen kinase 85)

Sign In for Pricing
View Details
Caveolin 1 Rabbit mAb
MBS8602500-01 0.1 mL

Caveolin 1 Rabbit mAb

Sign In for Pricing
View Details