Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdh20 Rabbit Polyclonal Antibody (Biotin)

Cdh20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cad20

UniProt

Q5DWV1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Cdh20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DVTIGTTIQIISAKDPDMTNNSIRYSIDRGSDPGRFFYVDITTGALMTAR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001012766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP hsa-miR-199b-5p AAV miRNA Vector
Amh1109400 500 ng

GFP hsa-miR-199b-5p AAV miRNA Vector

Sign In for Pricing
View Details
DNA Polymerase delta Interacting Protein p38, CT (Polymerase delta-interacting Protein 2, 38kD DNA Polymerase delta Interaction Protein, p38, HSPC017, POLD4, PDIP38, POLDIP2) (AP)
MBS6472679-01 0.2 mL

DNA Polymerase delta Interacting Protein p38, CT (Polymerase delta-interacting Protein 2, 38kD DNA Polymerase delta Interaction Protein, p38, HSPC017, POLD4, PDIP38, POLDIP2) (AP)

Sign In for Pricing
View Details
DNA Polymerase delta Interacting Protein p38, CT (Polymerase delta-interacting Protein 2, 38kD DNA Polymerase delta Interaction Protein, p38, HSPC017, POLD4, PDIP38, POLDIP2) (AP)
MBS6472679-02 5x 0.2 mL

DNA Polymerase delta Interacting Protein p38, CT (Polymerase delta-interacting Protein 2, 38kD DNA Polymerase delta Interaction Protein, p38, HSPC017, POLD4, PDIP38, POLDIP2) (AP)

Sign In for Pricing
View Details
Recombinant Human FAM162B Protein, His (Fc)-Avi-tagged
FAM162B-2904H 50 µg

Recombinant Human FAM162B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
FAM219B (NM_020447) Human Tagged ORF Clone
RC204945 10 µg

FAM219B (NM_020447) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Cytokeratin 19 Antibody
CQA0328-01 30 µL

Anti-Cytokeratin 19 Antibody

Sign In for Pricing
View Details