Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM107 Rabbit Polyclonal Antibody (HRP)

TMEM107 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MKS13, JBTS29, GRVS638, PRO1268

UniProt

Q6UX40

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM107

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_115730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal VEGFR3/Flt-4 Antibody (9D9) [mFluor Violet 500 SE]
NBP1-18651MFV500 0.1 mL

Mouse Monoclonal VEGFR3/Flt-4 Antibody (9D9) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Porcine FUN14 domain containing protein 1
MBS7277283-01 48 Well

Porcine FUN14 domain containing protein 1

Sign In for Pricing
View Details
Porcine FUN14 domain containing protein 1
MBS7277283-02 96 Well

Porcine FUN14 domain containing protein 1

Sign In for Pricing
View Details
Porcine FUN14 domain containing protein 1
MBS7277283-03 5x 96 Well

Porcine FUN14 domain containing protein 1

Sign In for Pricing
View Details
Porcine FUN14 domain containing protein 1
MBS7277283-04 10x 96 Well

Porcine FUN14 domain containing protein 1

Sign In for Pricing
View Details
CENPVL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15888061 1.0 µg DNA

CENPVL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details