Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR2A Rabbit Polyclonal Antibody (HRP)

TOR2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TORP1

UniProt

Q5JU69

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TOR2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078816

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBEGF Antibody, Biotin conjugated
CSB-PA857429LD01HU-01 50 µg

HBEGF Antibody, Biotin conjugated

Sign In for Pricing
View Details
HBEGF Antibody, Biotin conjugated
CSB-PA857429LD01HU-02 100 µg

HBEGF Antibody, Biotin conjugated

Sign In for Pricing
View Details
X-Blu UHC Western Blot/Autoradiography Film, 8x10in, 100 sheets/box
LW-UHC8x10 1 Box

X-Blu UHC Western Blot/Autoradiography Film, 8x10in, 100 sheets/box

Sign In for Pricing
View Details
MAP1ALC3, cleaved (LC3B, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associat
MBS6318254-01 0.2 mL

MAP1ALC3, cleaved (LC3B, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associat

Sign In for Pricing
View Details
MAP1ALC3, cleaved (LC3B, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associat
MBS6318254-02 5x 0.2 mL

MAP1ALC3, cleaved (LC3B, MAP1LC3B, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associat

Sign In for Pricing
View Details
RUNX2 Knockout Cell Lysate
ABC-KC1746 100 µg

RUNX2 Knockout Cell Lysate

Sign In for Pricing
View Details