Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZF1 Rabbit Polyclonal Antibody (FITC)

FEZF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FEZ, HH22, ZNF312B

UniProt

A0PJY2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FEZF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001019784

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (Dimethylamino) -6-Methylheptan-3-One
OR1025861-01 100 mg

1- (Dimethylamino) -6-Methylheptan-3-One

Sign In for Pricing
View Details
1- (Dimethylamino) -6-Methylheptan-3-One
OR1025861-02 250 mg

1- (Dimethylamino) -6-Methylheptan-3-One

Sign In for Pricing
View Details
1- (Dimethylamino) -6-Methylheptan-3-One
OR1025861-03 1 g

1- (Dimethylamino) -6-Methylheptan-3-One

Sign In for Pricing
View Details
1- (Dimethylamino) -6-Methylheptan-3-One
OR1025861-04 5 g

1- (Dimethylamino) -6-Methylheptan-3-One

Sign In for Pricing
View Details
ATP1B1 (Adenosinetriphosphatase, AT1B1_HUMAN, ATP 1B, ATP1B, ATP1B1, ATPase Na+/K+ transporting beta 1 Polypeptide, Atpb 1, ATPBS, Beta 1 Subunit of Na (+) K (+) ATPase, Na K ATPase beta 1 Polypeptide, Na+/K+ ATPase beta 1 Subunit, Sodium/Potassium Dependent ATPase beta 1 Subunit, Sodium/Potassium transporting ATPase beta 1 Chain, Sodium/Potassium transporting ATPase Subunit beta 1, Sodium/Potassium-Dependent ATPase Subunit beta-1, Sodium/Potassium-transporting ATPase Subunit beta-1, ) discontinued
220936-01 50 µL

ATP1B1 (Adenosinetriphosphatase, AT1B1_HUMAN, ATP 1B, ATP1B, ATP1B1, ATPase Na+/K+ transporting beta 1 Polypeptide, Atpb 1, ATPBS, Beta 1 Subunit of Na (+) K (+) ATPase, Na K ATPase beta 1 Polypeptide, Na+/K+ ATPase beta 1 Subunit, Sodium/Potassium Dependent ATPase beta 1 Subunit, Sodium/Potassium transporting ATPase beta 1 Chain, Sodium/Potassium transporting ATPase Subunit beta 1, Sodium/Potassium-Dependent ATPase Subunit beta-1, Sodium/Potassium-transporting ATPase Subunit beta-1, ) discontinued

Sign In for Pricing
View Details
ATP1B1 (Adenosinetriphosphatase, AT1B1_HUMAN, ATP 1B, ATP1B, ATP1B1, ATPase Na+/K+ transporting beta 1 Polypeptide, Atpb 1, ATPBS, Beta 1 Subunit of Na (+) K (+) ATPase, Na K ATPase beta 1 Polypeptide, Na+/K+ ATPase beta 1 Subunit, Sodium/Potassium Dependent ATPase beta 1 Subunit, Sodium/Potassium transporting ATPase beta 1 Chain, Sodium/Potassium transporting ATPase Subunit beta 1, Sodium/Potassium-Dependent ATPase Subunit beta-1, Sodium/Potassium-transporting ATPase Subunit beta-1, ) discontinued
220936-02 100 µL

ATP1B1 (Adenosinetriphosphatase, AT1B1_HUMAN, ATP 1B, ATP1B, ATP1B1, ATPase Na+/K+ transporting beta 1 Polypeptide, Atpb 1, ATPBS, Beta 1 Subunit of Na (+) K (+) ATPase, Na K ATPase beta 1 Polypeptide, Na+/K+ ATPase beta 1 Subunit, Sodium/Potassium Dependent ATPase beta 1 Subunit, Sodium/Potassium transporting ATPase beta 1 Chain, Sodium/Potassium transporting ATPase Subunit beta 1, Sodium/Potassium-Dependent ATPase Subunit beta-1, Sodium/Potassium-transporting ATPase Subunit beta-1, ) discontinued

Sign In for Pricing
View Details