Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Rabbit Polyclonal Antibody (HRP)

Lrrfip1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fl, Fliiap1, AU024550

UniProt

Q3UZ39

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp551 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3611902 1.0 µg DNA

Zfp551 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ASB10 AAV Vector (Rat) (CMV)
12503106 1 µg

ASB10 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
PCB 7 [CAS:33284-50-3] 100 ug/ml in Iso-octane
PCB007K1ZT1 1 mL

PCB 7 [CAS:33284-50-3] 100 ug/ml in Iso-octane

Sign In for Pricing
View Details
C11orf59 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV809809 1.0 µg DNA

C11orf59 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Naphthol AS-D C.I. No.37520
N01132-01 25 g

Naphthol AS-D C.I. No.37520

Sign In for Pricing
View Details
Naphthol AS-D C.I. No.37520
N01132-02 100 g

Naphthol AS-D C.I. No.37520

Sign In for Pricing
View Details