Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD3 Rabbit Polyclonal Antibody (FITC)

SMYD3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KMT3E, ZMYND1, ZNFN3A1, bA74P14.1

UniProt

Q9H7B4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SMYD3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073580

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEFM Antibody
orb524596-01 50 μL

NEFM Antibody

Sign In for Pricing
View Details
NEFM Antibody
orb524596-02 100 µL

NEFM Antibody

Sign In for Pricing
View Details
Nephrocystin 5 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2497662 100 µL

Nephrocystin 5 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Mouse Toll Like Receptor 1 (TLR1) ELISA Kit DIY Materials
MBS2089218-01 5x 96 Tests

Mouse Toll Like Receptor 1 (TLR1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Mouse Toll Like Receptor 1 (TLR1) ELISA Kit DIY Materials
MBS2089218-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Mouse Toll Like Receptor 1 (TLR1) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Mouse Toll Like Receptor 1 (TLR1) ELISA Kit DIY Materials
MBS2089218-03 10x 96 Tests

Mouse Toll Like Receptor 1 (TLR1) ELISA Kit DIY Materials

Sign In for Pricing
View Details