Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRY4 Rabbit Polyclonal Antibody (HRP)

SPRY4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HH17

UniProt

Q9C004

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPRY4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112226

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD55 / DAF ELISA Kit
NS-E10037-01 1 Each

Human CD55 / DAF ELISA Kit

Sign In for Pricing
View Details
Human CD55 / DAF ELISA Kit
NS-E10037-02 1 Each

Human CD55 / DAF ELISA Kit

Sign In for Pricing
View Details
Anti-Cdc25b Antibody Picoband®
A01899 100 µg/Vial

Anti-Cdc25b Antibody Picoband®

Sign In for Pricing
View Details
RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1, MGC15146, MGC3331, MSSP, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1) (AP) discontinued
250956-AP 100 µL

RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1, MGC15146, MGC3331, MSSP, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1) (AP) discontinued

Sign In for Pricing
View Details
BTG1 Rabbit Monoclonal Antibody
AMRe87710-01 1 Each

BTG1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BTG1 Rabbit Monoclonal Antibody
AMRe87710-02 50 µL

BTG1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details