Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF385B Rabbit Polyclonal Antibody (FITC)

ZNF385B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF533

UniProt

Q569K4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF385B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1020 CRISPR Activation Plasmid (m)
sc-434708-ACT 20 µg

Olfr1020 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
UIMC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2587005 3x 1.0 µg

UIMC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human BIK (BCL2 interacting killer) Full Length
MPC4035K Each

Magic™ Membrane Protein Human BIK (BCL2 interacting killer) Full Length

Sign In for Pricing
View Details
Sheep Elongation of Very Long Chain Fatty Acids-Like 2 (ELOVL2) ELISA Kit
MBS9920751-01 48 Well

Sheep Elongation of Very Long Chain Fatty Acids-Like 2 (ELOVL2) ELISA Kit

Sign In for Pricing
View Details
Sheep Elongation of Very Long Chain Fatty Acids-Like 2 (ELOVL2) ELISA Kit
MBS9920751-02 96 Well

Sheep Elongation of Very Long Chain Fatty Acids-Like 2 (ELOVL2) ELISA Kit

Sign In for Pricing
View Details
Sheep Elongation of Very Long Chain Fatty Acids-Like 2 (ELOVL2) ELISA Kit
MBS9920751-03 5x 96 Well

Sheep Elongation of Very Long Chain Fatty Acids-Like 2 (ELOVL2) ELISA Kit

Sign In for Pricing
View Details