Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcf23 Rabbit Polyclonal Antibody (Biotin)

Tcf23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ou, Out, bHLHa, bHLHa24, 2010002O16Rik

UniProt

Q9JLR5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_444315

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKZ Protein (N-GST, Human)
P523911 100 µg

DGKZ Protein (N-GST, Human)

Sign In for Pricing
View Details
Active Procollagen I C-Terminal Propeptide (PICP)
TRV-0001765-01 10 µg

Active Procollagen I C-Terminal Propeptide (PICP)

Sign In for Pricing
View Details
Active Procollagen I C-Terminal Propeptide (PICP)
TRV-0001765-02 50 µg

Active Procollagen I C-Terminal Propeptide (PICP)

Sign In for Pricing
View Details
Active Procollagen I C-Terminal Propeptide (PICP)
TRV-0001765-03 100 µg

Active Procollagen I C-Terminal Propeptide (PICP)

Sign In for Pricing
View Details
Active Procollagen I C-Terminal Propeptide (PICP)
TRV-0001765-04 200 µg

Active Procollagen I C-Terminal Propeptide (PICP)

Sign In for Pricing
View Details
Active Procollagen I C-Terminal Propeptide (PICP)
TRV-0001765-05 500 µg

Active Procollagen I C-Terminal Propeptide (PICP)

Sign In for Pricing
View Details