Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp72 Rabbit Polyclonal Antibody (FITC)

Zfp72 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Zfp7, Zfp74

UniProt

Q0VFY0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KECNKTFVRKSLLIQHQRVHTGEKPYKCEQCGKAFSCSSSLTPHQRIHTG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001075149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LCP1 shRNA (UAS) - Lentiviral human LCP1 shRNA (UAS, GFP) (25)
GTR15098420 1 Vial

Lentiviral human LCP1 shRNA (UAS) - Lentiviral human LCP1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human TIMP-2 ELISA Kit (Colorimetric)
NBP2-78715 1 Kit

Human TIMP-2 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Zar1l Rabbit Polyclonal Antibody
TA344420 100 µL

Zar1l Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Chromosome initiation inhibitor (iciA)
MBS1005935-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Chromosome initiation inhibitor (iciA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Chromosome initiation inhibitor (iciA)
MBS1005935-02 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Chromosome initiation inhibitor (iciA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Chromosome initiation inhibitor (iciA)
MBS1005935-03 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Chromosome initiation inhibitor (iciA)

Sign In for Pricing
View Details