Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFM4 Rabbit Polyclonal Antibody (HRP)

OLFM4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GC1, OLM4, OlfD, GW112, hGC-1, hOLfD, UNQ362, bA209J19.1

UniProt

Q6UX06

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OLFM4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hes7 Rabbit Polyclonal Antibody (HRP)
orb2129837 100 µL

Hes7 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-ACTH/POMC Antibody (Dylight488 Conjugate)
PB9039-Dylight488 100 µg

Anti-ACTH/POMC Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
2-Bromophenylacetic acid
sc-254182 5 g

2-Bromophenylacetic acid

Sign In for Pricing
View Details
[5- (1-adamantyl) -2-ethylphenyl]amine
sc-323314 100 mg

[5- (1-adamantyl) -2-ethylphenyl]amine

Sign In for Pricing
View Details
Recombinant Human Ras-related protein Rab-6C (RAB6C)
MBS1356077-01 0.02 mg (E-Coli)

Recombinant Human Ras-related protein Rab-6C (RAB6C)

Sign In for Pricing
View Details
Recombinant Human Ras-related protein Rab-6C (RAB6C)
MBS1356077-02 0.1 mg (E-Coli)

Recombinant Human Ras-related protein Rab-6C (RAB6C)

Sign In for Pricing
View Details