Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF3 Rabbit Polyclonal Antibody (HRP)

TAF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAF140, TAFII140, TAFII-140

UniProt

Q5VWG9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_114129

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL
BNC880282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA367219 100 µL

HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GFAP, Tag Free
HA210990-01 Inquire

Human GFAP, Tag Free

Sign In for Pricing
View Details
Human GFAP, Tag Free
HA210990-02 50 µg

Human GFAP, Tag Free

Sign In for Pricing
View Details
Human GFAP, Tag Free
HA210990-03 100 µg

Human GFAP, Tag Free

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details