Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARK7 Rabbit Polyclonal Antibody (HRP)

PARK7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DJ1, DJ-1, GATD2, HEL-S-67p

UniProt

Q99497

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PARK7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_009193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR1 Human Recombinant Protein, Synthetic Nanodisc
TP721806 10 µg

PAR1 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Anti-IFN gamma Antibody Picoband®, FITC Conjugate
RP1002-FITC 100 µg/Vial

Anti-IFN gamma Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus bioB Protein (aa 1-335) (strain N315)
VAng-Cr5640-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus bioB Protein (aa 1-335) (strain N315)

Sign In for Pricing
View Details
Protein farnesyltransferase subunit beta Antibody (APC)
orb3168592 100 µg

Protein farnesyltransferase subunit beta Antibody (APC)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri cyaY Protein (aa 1-106)
VAng-Lsx07679-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri cyaY Protein (aa 1-106)

Sign In for Pricing
View Details
FACL4 (ACSL4) (NM_022977) Human Tagged Lenti ORF Clone
RC221413L3 10 µg

FACL4 (ACSL4) (NM_022977) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details