Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 1, Human (65a.a, His)

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 1 Protein, Human (65a.a, His) is the recombinant human-derived NRG1-beta 1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NRG1-beta 1 Protein, Human (65a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1-protein-human.html

Purity

98.0

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Formula

3084 (Gene_ID) Q02297-6 (S177-E241) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-,  15nm
GP-5901-15 1 mL

Colloidal Gold Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-, 15nm

Sign In for Pricing
View Details
CTIP2 (BCL11B) (NM_001282238) Human Tagged ORF Clone
RG239635 10 µg

CTIP2 (BCL11B) (NM_001282238) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS804506 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
3-Hydroxy Benzopyrene O-Beta-D-glucuronide
TRC-H829405-1MG 1 mg

3-Hydroxy Benzopyrene O-Beta-D-glucuronide

Sign In for Pricing
View Details
PSTPIP1 Rabbit Polyclonal Antibody
TA362004 100 µL

PSTPIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isometamidium Chloride Hydrochloride
TRC-I821275-1MG 1 mg

Isometamidium Chloride Hydrochloride

Sign In for Pricing
View Details