Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 1, Human (65a.a, His)

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 1 Protein, Human (65a.a, His) is the recombinant human-derived NRG1-beta 1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NRG1-beta 1 Protein, Human (65a.a, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nrg-1-protein-human.html

Purity

98.0

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Formula

3084 (Gene_ID) Q02297-6 (S177-E241) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF488A conjugate, 0.1mg/mL
BNC881729-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details